PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000285490
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family TALE
Protein Properties Length: 230aa    MW: 26098.4 Da    PI: 7.6626
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000285490genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox25.71.9e-081451792155
                    HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
       Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                    k++yp ++++  LA+++gL+ +q+ +WF N+R ++
  MDP0000285490 145 KSPYPLEAQKLALAESTGLELKQINNWFINQRKRH 179
                    789*****************************885 PP

2ELK24.85e-0999120122
            ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                    ELK qL +K sgyLg+LkqEF+
  MDP0000285490  99 ELKVQLSHKCSGYLGTLKQEFM 120
                    9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512138.55699119IPR005539ELK domain
SMARTSM011880.001599120IPR005539ELK domain
PROSITE profilePS5007111.272119182IPR001356Homeobox domain
SMARTSM003892.0E-8121186IPR001356Homeobox domain
SuperFamilySSF466898.98E-18121193IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-24124184IPR009057Homeodomain-like
PfamPF059206.8E-16139178IPR008422Homeobox KN domain
CDDcd000863.68E-10145183No hitNo description
PROSITE patternPS000270157180IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MELKMLQEFK LVDSVKSEIG SEILRKHHRL HCSSDQLYKE LAVEXYDKHG GTGHGVGAAL  60
NVHEGPQAST SGGNFVGLDR SPEEANAIND IDPQAEDREL KVQLSHKCSG YLGTLKQEFM  120
KKKKNGKLPK EAWHQLLDWW CRHYKSPYPL EAQKLALAES TGLELKQINN WFINQRKRHW  180
KPSEDMQFVF DGPNSSSTPS LSPLLYGQCN LQSLLHGLHI YSPLIITFTC
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.15611e-130cell culture
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009365095.15e-65PREDICTED: homeobox protein knotted-1-like LET6
SwissprotP466086e-47HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLA5X9E93e-53A5X9E9_KALDA; STM protein (Fragment)
TrEMBLM5WU645e-53M5WU64_PRUPE; Uncharacterized protein
STRINGVIT_10s0116g00190.t013e-45(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.18e-47KNOX/ELK homeobox transcription factor